(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE172

CP002031.PE172       Location/Qualifiers
FT   CDS             177994..178203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83038"
FT                   /protein_id="ADI83038.2"
FT                   /translation="MLDTRKTTTGSPSTERCDIKTWSGACGHDSYTAIGDKYRCDLCGT
FT                   IADLSHEVKHDTFPYTSGDYDNLS"
     MLDTRKTTTG SPSTERCDIK TWSGACGHDS YTAIGDKYRC DLCGTIADLS HEVKHDTFPY        60
     TSGDYDNLS                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page