(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE173

CP002031.PE173       Location/Qualifiers
FT   CDS             178440..178910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0176"
FT                   /product="aerobic-type carbon monoxide dehydrogenase, small
FT                   subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83039"
FT                   /protein_id="ADI83039.1"
FT                   /translation="MIVFLVNGKEQRVDVSPDTPLLWVLRDKLGLTGTKYGCGEGLCGA
FT                   CTVHIDGRPERSCITPVGDVQGKKVVTIEGIPENHPVKQAWLAQEVSQCGYCQPGQIMS
FT                   AVALLASKPRPSDADIDTAMSGNLCRCGTYGRIRRAIHAAGGRRAQKGGNRS"
     MIVFLVNGKE QRVDVSPDTP LLWVLRDKLG LTGTKYGCGE GLCGACTVHI DGRPERSCIT        60
     PVGDVQGKKV VTIEGIPENH PVKQAWLAQE VSQCGYCQPG QIMSAVALLA SKPRPSDADI       120
     DTAMSGNLCR CGTYGRIRRA IHAAGGRRAQ KGGNRS                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page