(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE174

CP002031.PE174       Location/Qualifiers
FT   CDS             178907..181078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0177"
FT                   /product="aerobic-type carbon monoxide dehydrogenase, large
FT                   subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83040"
FT                   /protein_id="ADI83040.1"
FT                   /translation="MSNGNGMSRRQFMKTSAMAAGGLLLACHLPLGRRDAVAGTGDAFA
FT                   PNAFLHIGTDERVTVIVNKSEMGQGVYTSLPMLVAEELCCDWKRVTFRASPVASEYNHT
FT                   QFGPIMVTGGSTSVRSEWSRLSQAGAAAREMLIAAAAQEWRVEPAACRAEKGFVLGPGG
FT                   RKLSFGTLAPKAAALPVPKEPKLKQGAKTLLGKPLKRLDSPAKINGTAVFGIDVRAPGM
FT                   LTALIARPPVFGGTVKRFDVAKAKAVPGVRDVVAVDAGIAVVGEGFWPALKGREVLEIA
FT                   WDEGEGARVSTAAMSEEYARLAATPGAVARKDGDAPAELAKAARRFEAEYEVPYLAHAT
FT                   MEPLNCFVDLRSDSCLIRTGSQFQTGDRNAAARVAGLKPEQVTLETTFLGGGFGRRACP
FT                   ASDFVIEAVQVAKAVGKPVMVIRTREDDMRAGFYRPLWRDCVAACLDERGYPLAWHHRI
FT                   VGQSIMIGTPFEATIKNGIDDTSVEGAADTPYAIPNLQVELHSPRNPVPVLWWRSVGHS
FT                   HTAFVVESFLDELAHAAGKDPYQYRRALLAKHPRHLKVLETAARKAGWGKPLPKDRGRG
FT                   IAVHESFGSFIAQVAEVSLAGDGQVKVHRVVCAVDCGRIVNPDTIEAQMESGITFGLSA
FT                   ALHGAITLRNGRVEQGNFDDYPPVRMAEMPKVEVHIVLSGEDPGGIGEPGVPPIAPAVT
FT                   NALFAASGIRMRSLPLTPEAVKRAGGRAA"
     MSNGNGMSRR QFMKTSAMAA GGLLLACHLP LGRRDAVAGT GDAFAPNAFL HIGTDERVTV        60
     IVNKSEMGQG VYTSLPMLVA EELCCDWKRV TFRASPVASE YNHTQFGPIM VTGGSTSVRS       120
     EWSRLSQAGA AAREMLIAAA AQEWRVEPAA CRAEKGFVLG PGGRKLSFGT LAPKAAALPV       180
     PKEPKLKQGA KTLLGKPLKR LDSPAKINGT AVFGIDVRAP GMLTALIARP PVFGGTVKRF       240
     DVAKAKAVPG VRDVVAVDAG IAVVGEGFWP ALKGREVLEI AWDEGEGARV STAAMSEEYA       300
     RLAATPGAVA RKDGDAPAEL AKAARRFEAE YEVPYLAHAT MEPLNCFVDL RSDSCLIRTG       360
     SQFQTGDRNA AARVAGLKPE QVTLETTFLG GGFGRRACPA SDFVIEAVQV AKAVGKPVMV       420
     IRTREDDMRA GFYRPLWRDC VAACLDERGY PLAWHHRIVG QSIMIGTPFE ATIKNGIDDT       480
     SVEGAADTPY AIPNLQVELH SPRNPVPVLW WRSVGHSHTA FVVESFLDEL AHAAGKDPYQ       540
     YRRALLAKHP RHLKVLETAA RKAGWGKPLP KDRGRGIAVH ESFGSFIAQV AEVSLAGDGQ       600
     VKVHRVVCAV DCGRIVNPDT IEAQMESGIT FGLSAALHGA ITLRNGRVEQ GNFDDYPPVR       660
     MAEMPKVEVH IVLSGEDPGG IGEPGVPPIA PAVTNALFAA SGIRMRSLPL TPEAVKRAGG       720
     RAA                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page