(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE182

CP002031.PE182       Location/Qualifiers
FT   CDS             186988..187182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78311"
FT                   /protein_id="ADN78311.1"
FT                   /translation="MSPVCLTTKRENARRTSKAATVPPCFVFEVVSGLRLESWLDLLTA
FT                   YMSMLQIMALVCLTIYNIP"
     MSPVCLTTKR ENARRTSKAA TVPPCFVFEV VSGLRLESWL DLLTAYMSML QIMALVCLTI        60
     YNIP                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page