(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE183

CP002031.PE183       Location/Qualifiers
FT   CDS             187306..188298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0185"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83048"
FT                   /protein_id="ADI83048.1"
FT                   /translation="MRKFGFLAVFMSLSLVLLSTAMAAPPGGKVLIGVSKIVSHPALDA
FT                   VEKGLQDELAALKINAQYDLQNANGDANTAASIANKFQSEKVTLAVGIATPTAQSLVNT
FT                   LKTTPVVFSAVTDPVKAGLVKSLAKGEKYVTGVSDMTPVKQQIELLLKIKKVKRLGHIY
FT                   TSSEENAVVLAGVVKKACQDLGIQYVETTVSKSAEVKQATQSIIRRVDALYVSTDNTVV
FT                   SAMSALTDVAMKNKVPVMSADPSSAESHPVLAAWGFDYYKMGRATGKMVAEILKGKKPE
FT                   QLPTRFMTKASDVDLLVNLDVAKKLGLTVPAAIVKSANKVVENGKLTKK"
     MRKFGFLAVF MSLSLVLLST AMAAPPGGKV LIGVSKIVSH PALDAVEKGL QDELAALKIN        60
     AQYDLQNANG DANTAASIAN KFQSEKVTLA VGIATPTAQS LVNTLKTTPV VFSAVTDPVK       120
     AGLVKSLAKG EKYVTGVSDM TPVKQQIELL LKIKKVKRLG HIYTSSEENA VVLAGVVKKA       180
     CQDLGIQYVE TTVSKSAEVK QATQSIIRRV DALYVSTDNT VVSAMSALTD VAMKNKVPVM       240
     SADPSSAESH PVLAAWGFDY YKMGRATGKM VAEILKGKKP EQLPTRFMTK ASDVDLLVNL       300
     DVAKKLGLTV PAAIVKSANK VVENGKLTKK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page