(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE186

CP002031.PE186       Location/Qualifiers
FT   CDS             190058..191566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0188"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83051"
FT                   /protein_id="ADI83051.1"
FT                   /translation="MLLIHPPVAKPGEPPAGIARLAGELRAHGLHCRVLDASLEGLLWL
FT                   LEQPSPATDTWTRRASRSRADHVATLRGMDAYRSPDRYRRAVSDLNRLLAAAGRECGAV
FT                   PGLADYRQDGFSPVSSADLLRAAEEPERNPFHPWFSQRLPELLDGVRVAGLSLNYLSQA
FT                   VSAFAMIGFLRTRFPGLTLVLGGGLVTSWLRRPGWRNPFGGLVDHLVDGPGELPLLRLL
FT                   GAEEPLCRDVPPVYDPLPLHDYLSPGLVLPYSAAGGCYWNRCSFCPERAEGNAYRPRAV
FT                   QRVLADLETLVSRHQPALLHLLDNAVSPSLLQGMAAAPPGVPWYGFARVDEQLADPGFC
FT                   RTLRRSGCVMLKLGLESGDQGVLDRLHKGIDLATAARALRSLRAAGIAVYAYLLFGTPA
FT                   ETEEAARRTLAFVAEHREEIGFLNLAVFNMPISGDEADAYGTAPFYEGDLSLYTAFRHP
FT                   RGWDRKQVRRFLDREFTRHPAVAPILRRDPPVFTSNHAPFFAGG"
     MLLIHPPVAK PGEPPAGIAR LAGELRAHGL HCRVLDASLE GLLWLLEQPS PATDTWTRRA        60
     SRSRADHVAT LRGMDAYRSP DRYRRAVSDL NRLLAAAGRE CGAVPGLADY RQDGFSPVSS       120
     ADLLRAAEEP ERNPFHPWFS QRLPELLDGV RVAGLSLNYL SQAVSAFAMI GFLRTRFPGL       180
     TLVLGGGLVT SWLRRPGWRN PFGGLVDHLV DGPGELPLLR LLGAEEPLCR DVPPVYDPLP       240
     LHDYLSPGLV LPYSAAGGCY WNRCSFCPER AEGNAYRPRA VQRVLADLET LVSRHQPALL       300
     HLLDNAVSPS LLQGMAAAPP GVPWYGFARV DEQLADPGFC RTLRRSGCVM LKLGLESGDQ       360
     GVLDRLHKGI DLATAARALR SLRAAGIAVY AYLLFGTPAE TEEAARRTLA FVAEHREEIG       420
     FLNLAVFNMP ISGDEADAYG TAPFYEGDLS LYTAFRHPRG WDRKQVRRFL DREFTRHPAV       480
     APILRRDPPV FTSNHAPFFA GG                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page