(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE19

CP002031.PE19        Location/Qualifiers
FT   CDS             complement(28903..30339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0019"
FT                   /product="helix-turn-helix transcriptional regulator with
FT                   aminotransferase domain, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82882"
FT                   /protein_id="ADI82882.1"
FT                   /translation="MNTVKSGGKIPLYESVAGRVAQLIGEGTFRAGDRIPSVRALGRQF
FT                   QVSLTTVMEAYTLLEDRGLIEARPQSGYYVRARFPGSTAEPEMTAPPLKPTTVGTAELS
FT                   MMVMRDTRNPDLVPLGAAIPNPELLPVDRLNRMLATESRKHAVASVSYDMPPGCERLRV
FT                   QIARRMLAVGCALAPDQIVTTSGCIEAVVLSLRAICRPGDTVAVESPVYYNFLQAIDLM
FT                   GLKALEIPTHPRTGISLDALRYALDHTPIRACLVVANFNNPLGSLMPDDHKRELVAMLA
FT                   ARRIPLIEDDIYGDLSFSPERPRAAKAFDEAGLVLYCTSVTKTVAPGYRVGWVAPGIFQ
FT                   KEIERLKAVTTIACSTPTELAVAEFLANGGYDHHLRRIRRIYARQMSLMAEAVGQAFPV
FT                   GTRVTRPEGGFVLWVECPERVDSLVLYEQALTRGITIAPGPIFSATGKYRNCIRLNAAW
FT                   WDDRVERAIHTLGELAAAMM"
     MNTVKSGGKI PLYESVAGRV AQLIGEGTFR AGDRIPSVRA LGRQFQVSLT TVMEAYTLLE        60
     DRGLIEARPQ SGYYVRARFP GSTAEPEMTA PPLKPTTVGT AELSMMVMRD TRNPDLVPLG       120
     AAIPNPELLP VDRLNRMLAT ESRKHAVASV SYDMPPGCER LRVQIARRML AVGCALAPDQ       180
     IVTTSGCIEA VVLSLRAICR PGDTVAVESP VYYNFLQAID LMGLKALEIP THPRTGISLD       240
     ALRYALDHTP IRACLVVANF NNPLGSLMPD DHKRELVAML AARRIPLIED DIYGDLSFSP       300
     ERPRAAKAFD EAGLVLYCTS VTKTVAPGYR VGWVAPGIFQ KEIERLKAVT TIACSTPTEL       360
     AVAEFLANGG YDHHLRRIRR IYARQMSLMA EAVGQAFPVG TRVTRPEGGF VLWVECPERV       420
     DSLVLYEQAL TRGITIAPGP IFSATGKYRN CIRLNAAWWD DRVERAIHTL GELAAAMM         478
//

If you have problems or comments...

PBIL Back to PBIL home page