(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE197

CP002031.PE197       Location/Qualifiers
FT   CDS             complement(200465..200797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0199"
FT                   /product="cupin superfamily barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83062"
FT                   /protein_id="ADI83062.1"
FT                   /translation="MSTGNETLAGRAIGMSELAQYQPGSVVSRTLIDKKIGTITLFAFD
FT                   EGQGLSEHTAPYDAFVQIVDGVADITIDGQVHRVAAGQMIIMPADRPHALRAVERFKML
FT                   LVMIRA"
     MSTGNETLAG RAIGMSELAQ YQPGSVVSRT LIDKKIGTIT LFAFDEGQGL SEHTAPYDAF        60
     VQIVDGVADI TIDGQVHRVA AGQMIIMPAD RPHALRAVER FKMLLVMIRA                  110
//

If you have problems or comments...

PBIL Back to PBIL home page