(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE199

CP002031.PE199       Location/Qualifiers
FT   CDS             201191..202816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0201"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83064"
FT                   /protein_id="ADI83064.1"
FT                   /translation="MFLEVIPLTLSLLLTLLPIAVILVMLLVFRKAADVSGIIGWLAIS
FT                   VVAWLGFQTAPEVILRSTAAGFIRSFSVSLIVATSLLQMALMEKTGALRRITIFIRTIA
FT                   SDNRAVQIMMINIGFGTLMVAVGATPVSILPPILLAMGYSTYVAIALPAIGYDSLCTYA
FT                   LLGAPIVVFVDIANSFLGKGNEIALHQAGMVFFMFLPVVSTMIGFCMLWIVGKWQAIRE
FT                   GWLPCLLTGAVIGVVARFTNQYDNLVVLTGVLCGIAVIAAMAAYLVVTGGTVIDRSLLT
FT                   AEEREFAAVMPLWRAFMPWTLLVVLILVLNVPQDLFSWLYRTMKLPITGLTADGKPLDT
FT                   RALWQAYTWILVSTILATPFLKPTGEQLRETLRVWARRAPRPVFAAAIFFAIGEIMNMA
FT                   GYDMAAGRFVVPSMVKVLADSSALAFQGMYGEVVAFIGLFGGFITGSEASTIAMFAKYT
FT                   MTTAKNLDMPLSGLIIVTAGLAFGGGLASVISPAKLQNAAAAIDRIGEEGKVIRIAFVF
FT                   ALLLTLVTSLFVVVLLTVNGMGRV"
     MFLEVIPLTL SLLLTLLPIA VILVMLLVFR KAADVSGIIG WLAISVVAWL GFQTAPEVIL        60
     RSTAAGFIRS FSVSLIVATS LLQMALMEKT GALRRITIFI RTIASDNRAV QIMMINIGFG       120
     TLMVAVGATP VSILPPILLA MGYSTYVAIA LPAIGYDSLC TYALLGAPIV VFVDIANSFL       180
     GKGNEIALHQ AGMVFFMFLP VVSTMIGFCM LWIVGKWQAI REGWLPCLLT GAVIGVVARF       240
     TNQYDNLVVL TGVLCGIAVI AAMAAYLVVT GGTVIDRSLL TAEEREFAAV MPLWRAFMPW       300
     TLLVVLILVL NVPQDLFSWL YRTMKLPITG LTADGKPLDT RALWQAYTWI LVSTILATPF       360
     LKPTGEQLRE TLRVWARRAP RPVFAAAIFF AIGEIMNMAG YDMAAGRFVV PSMVKVLADS       420
     SALAFQGMYG EVVAFIGLFG GFITGSEAST IAMFAKYTMT TAKNLDMPLS GLIIVTAGLA       480
     FGGGLASVIS PAKLQNAAAA IDRIGEEGKV IRIAFVFALL LTLVTSLFVV VLLTVNGMGR       540
     V                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page