(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE205

CP002031.PE205       Location/Qualifiers
FT   CDS             209297..209956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0207"
FT                   /product="protein of unknown function DUF480"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83070"
FT                   /protein_id="ADI83070.1"
FT                   /translation="MEILLNDVEVRVLGCLIEKELATPEYYPLTLNSLTTACNQKSNRD
FT                   PVMALEESEVVRALDGLKMKHVAIQAADSGRVPRYRHILSERLRFSPAELAILAELLLR
FT                   GPQTLGELRTRAERMHPFADLAAVEQVLGELAERTPPLVMRLPRQPGRKESRFAHLLAG
FT                   EPDLSAEERTAPPEGARLQVMAENERIAALELEVATLRAEVGELRQVMEEFRSQFE"
     MEILLNDVEV RVLGCLIEKE LATPEYYPLT LNSLTTACNQ KSNRDPVMAL EESEVVRALD        60
     GLKMKHVAIQ AADSGRVPRY RHILSERLRF SPAELAILAE LLLRGPQTLG ELRTRAERMH       120
     PFADLAAVEQ VLGELAERTP PLVMRLPRQP GRKESRFAHL LAGEPDLSAE ERTAPPEGAR       180
     LQVMAENERI AALELEVATL RAEVGELRQV MEEFRSQFE                              219
//

If you have problems or comments...

PBIL Back to PBIL home page