(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE208

CP002031.PE208       Location/Qualifiers
FT   CDS             complement(213153..213569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0210"
FT                   /product="protein of unknown function DUF393"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83073"
FT                   /protein_id="ADI83073.1"
FT                   /translation="MPTPPAFPLTVFYDGACSVCAAEMAVYRRKNHGGRLVFVDISDPA
FT                   FDPSPWGITLEAFMAQMHAIDRDGRAYRGVEGFWAIWQAFPASTFYGLLGTLVMLPGFN
FT                   LLARLGYRGFARIRRYLPKRASRCDGGTCRMDRH"
     MPTPPAFPLT VFYDGACSVC AAEMAVYRRK NHGGRLVFVD ISDPAFDPSP WGITLEAFMA        60
     QMHAIDRDGR AYRGVEGFWA IWQAFPASTF YGLLGTLVML PGFNLLARLG YRGFARIRRY       120
     LPKRASRCDG GTCRMDRH                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page