(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE209

CP002031.PE209       Location/Qualifiers
FT   CDS             complement(213581..214057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0211"
FT                   /product="dehydratase, NodN/MaoC domain-containing,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83074"
FT                   /protein_id="ADI83074.1"
FT                   /translation="MSAADDLIAFLAPKLGTETHVGPWLTVDQERIDRFAHVTGDIQWI
FT                   HTDPERARRESPYGATVAHGFLTLSLLPCLTEANHPDFFQRNYPGMRLRVNYGLNRVRF
FT                   PQPVIVGSRLRARTLLKAVEPLAGAVQITYEITVEIEGKDKPACVAEQVVRVYP"
     MSAADDLIAF LAPKLGTETH VGPWLTVDQE RIDRFAHVTG DIQWIHTDPE RARRESPYGA        60
     TVAHGFLTLS LLPCLTEANH PDFFQRNYPG MRLRVNYGLN RVRFPQPVIV GSRLRARTLL       120
     KAVEPLAGAV QITYEITVEI EGKDKPACVA EQVVRVYP                               158
//

If you have problems or comments...

PBIL Back to PBIL home page