(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE218

CP002031.PE218       Location/Qualifiers
FT   CDS             complement(221385..222215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0220"
FT                   /product="polysaccharide deacetylase and DUF3473 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83083"
FT                   /protein_id="ADI83083.1"
FT                   /translation="MPVLNALTIDVEDWYHVCGLPGEPVVSPDTERVVPAVGRLLALLA
FT                   GRGCRATFFLLGSVAERHPGLAPSIAEAGHEIASHGWSHRLVTGLSPEEFRTELRRTGD
FT                   LLERQTGRRPVGFRAPQWSLCRRRTPWAFPILRDEGYRYDSSLSPLPFVGDRRGPRGPF
FT                   RIDTPAGPLVEVPPLVTRTPLGNLPTGGGWGFRFFPLGLIGASVAGLNRRGMPAVLYVH
FT                   PREVDPEGPRLALPPLRSFVAYGPRSDAAPRLDALLERFSFTTLDQLVDRWDTV"
     MPVLNALTID VEDWYHVCGL PGEPVVSPDT ERVVPAVGRL LALLAGRGCR ATFFLLGSVA        60
     ERHPGLAPSI AEAGHEIASH GWSHRLVTGL SPEEFRTELR RTGDLLERQT GRRPVGFRAP       120
     QWSLCRRRTP WAFPILRDEG YRYDSSLSPL PFVGDRRGPR GPFRIDTPAG PLVEVPPLVT       180
     RTPLGNLPTG GGWGFRFFPL GLIGASVAGL NRRGMPAVLY VHPREVDPEG PRLALPPLRS       240
     FVAYGPRSDA APRLDALLER FSFTTLDQLV DRWDTV                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page