(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE220

CP002031.PE220       Location/Qualifiers
FT   CDS             223861..225147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0222"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase with cobalamin-binding-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83085"
FT                   /protein_id="ADI83085.1"
FT                   /translation="MSRSPRLLLIYPATHKLGWARYFQLPSHSLQMVAAATPRHWEVIL
FT                   ADEVHDEVPFDGTFDLVGITAMTHQATRAYEIADRFRARGVPVVMGGIHPTVLPDEALE
FT                   HADAVVVGEAEPVWAHLLDDLLAGRLAPVYRAPVPTDEILSAPWPRREILAGRRYLTTQ
FT                   TVQASRGCPYDCSFCTVTPYFGRTFRYRDPDDILAEIRSFRRKLVVFLDDNLLGDPIKA
FT                   RPILRGLAEMDVRWGSQTNLRFAEDPELLKLVADSGCIGLFVGIESVTGSHANMAKSGT
FT                   RYSQTDLMKRVRDAGIILETSIIFGFDDHDESVFETTLRFLEECSPSVPTFHILTPYPG
FT                   TALFRQFQEEGRLLTTDWSRYDHSTVVFRPRLMSPERLHRGWLEARREAYSWRAIATRV
FT                   MRNPGRRLTNLAYNMLRKGPNDLLEDGAP"
     MSRSPRLLLI YPATHKLGWA RYFQLPSHSL QMVAAATPRH WEVILADEVH DEVPFDGTFD        60
     LVGITAMTHQ ATRAYEIADR FRARGVPVVM GGIHPTVLPD EALEHADAVV VGEAEPVWAH       120
     LLDDLLAGRL APVYRAPVPT DEILSAPWPR REILAGRRYL TTQTVQASRG CPYDCSFCTV       180
     TPYFGRTFRY RDPDDILAEI RSFRRKLVVF LDDNLLGDPI KARPILRGLA EMDVRWGSQT       240
     NLRFAEDPEL LKLVADSGCI GLFVGIESVT GSHANMAKSG TRYSQTDLMK RVRDAGIILE       300
     TSIIFGFDDH DESVFETTLR FLEECSPSVP TFHILTPYPG TALFRQFQEE GRLLTTDWSR       360
     YDHSTVVFRP RLMSPERLHR GWLEARREAY SWRAIATRVM RNPGRRLTNL AYNMLRKGPN       420
     DLLEDGAP                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page