(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE221

CP002031.PE221       Location/Qualifiers
FT   CDS             225208..226185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0223"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83086"
FT                   /protein_id="ADI83086.1"
FT                   /translation="MTRLIVFGILAAFFFSSTFVFNRAMSLEGGHWAWTASLRYGYMLL
FT                   LLCTWLLLKGRRGVVVAAWDAFRRNWLFWTTAGSVGFGAFYALISFSASFAPGWVVATT
FT                   WQITILATPVVLLLFGRRVPARGVLFTAMIFLGIVLVTLEQATAAPLGDILRGIVPVVA
FT                   AAFAYPLGNQMVWEARHGTSSLLPAITDPVVDDSFGRVLLMVLGSIPFWVVLLIVAAPP
FT                   PPSPGQLVNTALVAVFSGVIATSLFLHARHCASTTYELAAIDATQSTEVIFSLLGEIVF
FT                   LHGLLPGSSGTAGLVLVVGGLMLYVRAQTAGQLKEKIHSRAEKG"
     MTRLIVFGIL AAFFFSSTFV FNRAMSLEGG HWAWTASLRY GYMLLLLCTW LLLKGRRGVV        60
     VAAWDAFRRN WLFWTTAGSV GFGAFYALIS FSASFAPGWV VATTWQITIL ATPVVLLLFG       120
     RRVPARGVLF TAMIFLGIVL VTLEQATAAP LGDILRGIVP VVAAAFAYPL GNQMVWEARH       180
     GTSSLLPAIT DPVVDDSFGR VLLMVLGSIP FWVVLLIVAA PPPPSPGQLV NTALVAVFSG       240
     VIATSLFLHA RHCASTTYEL AAIDATQSTE VIFSLLGEIV FLHGLLPGSS GTAGLVLVVG       300
     GLMLYVRAQT AGQLKEKIHS RAEKG                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page