(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE227

CP002031.PE227       Location/Qualifiers
FT   CDS             232781..233218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0228"
FT                   /product="hemerythrin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83091"
FT                   /protein_id="ADI83091.1"
FT                   /translation="MGTADSSASNSNKASQKFIVWQDSYSVGVPKLDGQHKKIIDLINE
FT                   VYDYLQGRTGLLDLGRILDDLSTYTQNHFADEEQLLRLAKYPEYEEHKKHHDWMMQRTR
FT                   SIRSEYREKREDLSWELMDFLKKWWLSHIQSNDARYVPYVK"
     MGTADSSASN SNKASQKFIV WQDSYSVGVP KLDGQHKKII DLINEVYDYL QGRTGLLDLG        60
     RILDDLSTYT QNHFADEEQL LRLAKYPEYE EHKKHHDWMM QRTRSIRSEY REKREDLSWE       120
     LMDFLKKWWL SHIQSNDARY VPYVK                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page