(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE232

CP002031.PE232       Location/Qualifiers
FT   CDS             complement(235091..236857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0233"
FT                   /product="monovalent cation/proton antiporter family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83096"
FT                   /protein_id="ADI83096.1"
FT                   /translation="MHDLGLIMTITGSFTAALLLGYLTHRLGMSSIVGYLLAGIAVGTH
FT                   TPGFVADLGMAEQFAEIGVILLMFGVGLQFHVKELLDVRRVAIPGAVCQSAVATLLSCL
FT                   LARWLGWSWSAGIVFGFAVSVASTVVLLRVLVDNNELHTPTGHIAVGWLVVEDIFTVFL
FT                   LVILPIFFGSGVAGSDSLPLATGLSVVKIALLVALTFFVGSRLIPRLLWHVAATRSREL
FT                   FTLTVLVLALGIAVGSAKLFGVSMALGAFLAGMVVRQSDFSFRAASEALPMRDAFAVLF
FT                   FVSVGMLFNPTYLMEEPGLVLATLVIILVGKPLAALVIVLVLGYAPRVALSIAVALAQI
FT                   GEFSFILATVGKDLGVLGEGGANTLVAASIISISLNPLLYRLIGPLEKKARHWRLWRML
FT                   DERAKSRTTGSAEDAGSHVLTSRNRAIVVGYGPTGRTLARLLSENGIDPVIIEMNLHTV
FT                   RQLNADGTLAIYGDATREETLKGAGVESAVAFILTSAGMQGSDEAIRLARELNPNLRII
FT                   ARAAYLRDIPALRRAGADAVFSGEGEIALNMTEHMLNKLGATPEQIDRERERVRSELLG
FT                   GTPAVTPLATDH"
     MHDLGLIMTI TGSFTAALLL GYLTHRLGMS SIVGYLLAGI AVGTHTPGFV ADLGMAEQFA        60
     EIGVILLMFG VGLQFHVKEL LDVRRVAIPG AVCQSAVATL LSCLLARWLG WSWSAGIVFG       120
     FAVSVASTVV LLRVLVDNNE LHTPTGHIAV GWLVVEDIFT VFLLVILPIF FGSGVAGSDS       180
     LPLATGLSVV KIALLVALTF FVGSRLIPRL LWHVAATRSR ELFTLTVLVL ALGIAVGSAK       240
     LFGVSMALGA FLAGMVVRQS DFSFRAASEA LPMRDAFAVL FFVSVGMLFN PTYLMEEPGL       300
     VLATLVIILV GKPLAALVIV LVLGYAPRVA LSIAVALAQI GEFSFILATV GKDLGVLGEG       360
     GANTLVAASI ISISLNPLLY RLIGPLEKKA RHWRLWRMLD ERAKSRTTGS AEDAGSHVLT       420
     SRNRAIVVGY GPTGRTLARL LSENGIDPVI IEMNLHTVRQ LNADGTLAIY GDATREETLK       480
     GAGVESAVAF ILTSAGMQGS DEAIRLAREL NPNLRIIARA AYLRDIPALR RAGADAVFSG       540
     EGEIALNMTE HMLNKLGATP EQIDRERERV RSELLGGTPA VTPLATDH                    588
//

If you have problems or comments...

PBIL Back to PBIL home page