(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE235

CP002031.PE235       Location/Qualifiers
FT   CDS             complement(239081..239983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0236"
FT                   /product="membrane transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83099"
FT                   /protein_id="ADI83099.1"
FT                   /translation="MHNFLIIGAFISLGILLRRFKALPEHTPFVLNKIAINVCLPALIL
FT                   LNAPKIAFTRDAVTAAIIPWALLALSVGLVLLGAKIWQWPRPVVGVLFLIVPLGNTSFL
FT                   GVPIIRTFFGADGLPHLIVYDQIGTMMIFATYGSFILSLYGQDGTLSVSAVVRKMLLFP
FT                   PSLALAAGLALKSWSYPDGLSLALHYLALPLVPVVMTAIGLQLRLRLPPHLAAPVGIGL
FT                   GIKMLAAPLAVLVACRLVDMNGLAVGVSVVEAGMPPMVTAGALAVVAGMEAELAIALVG
FT                   IGILCSFGSLPALFWLVSL"
     MHNFLIIGAF ISLGILLRRF KALPEHTPFV LNKIAINVCL PALILLNAPK IAFTRDAVTA        60
     AIIPWALLAL SVGLVLLGAK IWQWPRPVVG VLFLIVPLGN TSFLGVPIIR TFFGADGLPH       120
     LIVYDQIGTM MIFATYGSFI LSLYGQDGTL SVSAVVRKML LFPPSLALAA GLALKSWSYP       180
     DGLSLALHYL ALPLVPVVMT AIGLQLRLRL PPHLAAPVGI GLGIKMLAAP LAVLVACRLV       240
     DMNGLAVGVS VVEAGMPPMV TAGALAVVAG MEAELAIALV GIGILCSFGS LPALFWLVSL       300
//

If you have problems or comments...

PBIL Back to PBIL home page