(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE239

CP002031.PE239       Location/Qualifiers
FT   CDS             243204..243518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83104"
FT                   /protein_id="ADI83104.2"
FT                   /translation="MTSPNQPENEGVVPIELILARLLRIGSIIAAILLAIGIAATLLTG
FT                   AAYAPRFITAGLVVLLATPIMRVLVAGLVFFRERDWLFTLFCLVVLCSLAAGVLLGQVG
FT                   "
     MTSPNQPENE GVVPIELILA RLLRIGSIIA AILLAIGIAA TLLTGAAYAP RFITAGLVVL        60
     LATPIMRVLV AGLVFFRERD WLFTLFCLVV LCSLAAGVLL GQVG                        104
//

If you have problems or comments...

PBIL Back to PBIL home page