(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE248

CP002031.PE248       Location/Qualifiers
FT   CDS             complement(255567..256832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0249"
FT                   /product="efflux pump, RND family, outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83112"
FT                   /protein_id="ADI83112.2"
FT                   /translation="MGSVRTRVLGAVIGALCLAATAWGQEAPMTGDGLDVALNFAAIGH
FT                   PSIKSQVAELKALGSDLKSAEYKRYPALTIQAQTMTNNQNQVVAVVQQPLWVGGRIDGG
FT                   IEQADVGLRIGRAALLDVRRRVMEETSAAYATLRGALQRLKAAELNVGEHEKLKGLVSR
FT                   RVEGGVASNADILLAESRLSQAIAQRIQLKGAVSRARSDLLALTQQPVAGNEPVPAHLL
FT                   ELPEPERMAEMIVKTSATVEQRILKVEDARITSRLAVASMMPALYAKVEQNVYVAERYG
FT                   ETPHETRFGVVLQGSVEGLGLSGWKKVKASDSRIDAARKEVAAAENDVRRQAEALVTDI
FT                   LSLRQVVRSYELLVTSTEETLASFLRQYDAGRKSWVDVLNAQREFSEARISLEQARSSL
FT                   EEASLRLAARLGQLDSFTGGNE"
     MGSVRTRVLG AVIGALCLAA TAWGQEAPMT GDGLDVALNF AAIGHPSIKS QVAELKALGS        60
     DLKSAEYKRY PALTIQAQTM TNNQNQVVAV VQQPLWVGGR IDGGIEQADV GLRIGRAALL       120
     DVRRRVMEET SAAYATLRGA LQRLKAAELN VGEHEKLKGL VSRRVEGGVA SNADILLAES       180
     RLSQAIAQRI QLKGAVSRAR SDLLALTQQP VAGNEPVPAH LLELPEPERM AEMIVKTSAT       240
     VEQRILKVED ARITSRLAVA SMMPALYAKV EQNVYVAERY GETPHETRFG VVLQGSVEGL       300
     GLSGWKKVKA SDSRIDAARK EVAAAENDVR RQAEALVTDI LSLRQVVRSY ELLVTSTEET       360
     LASFLRQYDA GRKSWVDVLN AQREFSEARI SLEQARSSLE EASLRLAARL GQLDSFTGGN       420
     E                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page