(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE252

CP002031.PE252       Location/Qualifiers
FT   CDS             complement(278622..280424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0253"
FT                   /product="sensor histidine kinase, GAF and GAF
FT                   domain-containing, nonconserved putative heme-binding site"
FT                   /note="domains: GAF, GAF, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83116"
FT                   /protein_id="ADI83116.1"
FT                   /translation="MAVHDPYTILSSAIRIANATERSHDERLKTLALLIAEAFGALSAT
FT                   FYLLDGDGRVIVRKISSAFSDICSRDCRIPGGRGIAGLCASSGKPIRQDCAGCHPDEVV
FT                   TGNERTIAAFPVSCQGQSLGVLALGFAHDAPLTDDDRDMLAVVLIEAAGVMRCKRQLES
FT                   VEKRIRELSFLNRINGVMLSTIELNRLIHLLLTALTSDQPPLFDRAMLFLLNERAGILQ
FT                   GMMGITSARQTDSNAPSEPRTKRRFPVRNADFDSVVKATRLPLDASLNQISRAVLERTL
FT                   LHVQHPDQEQPVDRTLTKQFGTSSYAVAPLVSQDRVVGAIVVDNRLTDRPLAGDDLGIL
FT                   HLVSGQAGMAIENSILFHRLEETNRNLQDAKERLLQEEKLAAIGRMAASIAHEIKNPLV
FT                   SVGGFAGRLKRKFTPESEEWLYADVIGREVQHLEKMLSDILFFSRKTTICYTRCGINQI
FT                   IEDGLATMAVPLEQREIVVDKRFASRLPTLLGDCQQLRHVFTNLISNALDVMEPQGVLT
FT                   IETGLARIDGKRAVSVKVGDTGSGIAPDVRHSIFTPFFTTKEKGTGLGLAIVHRIITNH
FT                   GGRIEVENRPEGGALFTVVLPTSP"
     MAVHDPYTIL SSAIRIANAT ERSHDERLKT LALLIAEAFG ALSATFYLLD GDGRVIVRKI        60
     SSAFSDICSR DCRIPGGRGI AGLCASSGKP IRQDCAGCHP DEVVTGNERT IAAFPVSCQG       120
     QSLGVLALGF AHDAPLTDDD RDMLAVVLIE AAGVMRCKRQ LESVEKRIRE LSFLNRINGV       180
     MLSTIELNRL IHLLLTALTS DQPPLFDRAM LFLLNERAGI LQGMMGITSA RQTDSNAPSE       240
     PRTKRRFPVR NADFDSVVKA TRLPLDASLN QISRAVLERT LLHVQHPDQE QPVDRTLTKQ       300
     FGTSSYAVAP LVSQDRVVGA IVVDNRLTDR PLAGDDLGIL HLVSGQAGMA IENSILFHRL       360
     EETNRNLQDA KERLLQEEKL AAIGRMAASI AHEIKNPLVS VGGFAGRLKR KFTPESEEWL       420
     YADVIGREVQ HLEKMLSDIL FFSRKTTICY TRCGINQIIE DGLATMAVPL EQREIVVDKR       480
     FASRLPTLLG DCQQLRHVFT NLISNALDVM EPQGVLTIET GLARIDGKRA VSVKVGDTGS       540
     GIAPDVRHSI FTPFFTTKEK GTGLGLAIVH RIITNHGGRI EVENRPEGGA LFTVVLPTSP       600
//

If you have problems or comments...

PBIL Back to PBIL home page