(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE260

CP002031.PE260       Location/Qualifiers
FT   CDS             complement(join(287498..288107,288109..288557))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0262"
FT                   /product="CheR-related putative SAM-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83125"
FT                   /protein_id="ADI83125.2"
FT                   /translation="MSPHHTPLHPCFDPAETSNELSRLLVSGPIVDADLDRRIARLRER
FT                   FRIYCGIYPFGMWDSGLVVTREMRALTDLLLPLAEILPAFSRLFRLTLRFPPLLEATPL
FT                   TTACSWLDLLERLDVSAARGNPARLLEQLAGDGARRTSFVFSLFIPRHYGGGFDRYPDQ
FT                   TAFLKRWIRQRGTPEGGIFSVLDAACGCGEGTYALARLLMGMGVAPDRFRVLGSSLEEI
FT                   ELFAARHAFFPHDQRRGEVLRSFAAPLLAAGAATSIGFVREDIREATGGAWDVILCNGI
FT                   LGGPFIHDRQTLERTIARLAARLAPGGLIVAADRFHEGWKRRVPAAMLEEMLRGAGLTV
FT                   LTVGEGVAGVRP"
FT                   /artificial_location="low-quality sequence region"
     MSPHHTPLHP CFDPAETSNE LSRLLVSGPI VDADLDRRIA RLRERFRIYC GIYPFGMWDS        60
     GLVVTREMRA LTDLLLPLAE ILPAFSRLFR LTLRFPPLLE ATPLTTACSW LDLLERLDVS       120
     AARGNPARLL EQLAGDGARR TSFVFSLFIP RHYGGGFDRY PDQTAFLKRW IRQRGTPEGG       180
     IFSVLDAACG CGEGTYALAR LLMGMGVAPD RFRVLGSSLE EIELFAARHA FFPHDQRRGE       240
     VLRSFAAPLL AAGAATSIGF VREDIREATG GAWDVILCNG ILGGPFIHDR QTLERTIARL       300
     AARLAPGGLI VAADRFHEGW KRRVPAAMLE EMLRGAGLTV LTVGEGVAGV RP               352
//

If you have problems or comments...

PBIL Back to PBIL home page