(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE261

CP002031.PE261       Location/Qualifiers
FT   CDS             288616..288948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83126"
FT                   /protein_id="ADI83126.2"
FT                   /translation="MIMLQRLWTFILVTAWCLVPPFTKNGSPCAGTAASVGSRGPGGVQ
FT                   RDLAPLARFLSCPESGVDHNGELSLFIPHCPALAGPLLLFRLKRTGFSLCRALIREGGI
FT                   LLSARR"
     MIMLQRLWTF ILVTAWCLVP PFTKNGSPCA GTAASVGSRG PGGVQRDLAP LARFLSCPES        60
     GVDHNGELSL FIPHCPALAG PLLLFRLKRT GFSLCRALIR EGGILLSARR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page