(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE27

CP002031.PE27        Location/Qualifiers
FT   CDS             complement(36596..37336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0027"
FT                   /product="periplasmic energy transduction protein,
FT                   TonB-related"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82890"
FT                   /protein_id="ADI82890.3"
FT                   /translation="MNRSIAHREPGLGWGLAASAMLHLALAALALVAQFNVPRYTEAPV
FT                   YYVDVVNLPVASPRAGSPTVGGAPPELPPPASQAMATPRLTPHTPAAVGKKSPTAADTG
FT                   KEFEDRLSALQRNVDERRQEAALDALRRKVNGSGRAEPAGMPSATGTQAGSDYAAYIQS
FT                   RLRDAFRYTIAHQAKTPEVVIRLTIDPRGRVTRQRIERSTGDRIFEESVMKAIAMAEKT
FT                   FAPPPSGGEFETGFIFRPEGVGKR"
     MNRSIAHREP GLGWGLAASA MLHLALAALA LVAQFNVPRY TEAPVYYVDV VNLPVASPRA        60
     GSPTVGGAPP ELPPPASQAM ATPRLTPHTP AAVGKKSPTA ADTGKEFEDR LSALQRNVDE       120
     RRQEAALDAL RRKVNGSGRA EPAGMPSATG TQAGSDYAAY IQSRLRDAFR YTIAHQAKTP       180
     EVVIRLTIDP RGRVTRQRIE RSTGDRIFEE SVMKAIAMAE KTFAPPPSGG EFETGFIFRP       240
     EGVGKR                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page