(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE28

CP002031.PE28        Location/Qualifiers
FT   CDS             complement(37333..37752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0028"
FT                   /product="biopolymer transport membrane protein,
FT                   TolR-related"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82891"
FT                   /protein_id="ADI82891.1"
FT                   /translation="MEVGSRNSGDRGTMSQINVTPLVDVMLVLLIIFMVTAPMMQQGVQ
FT                   VNLPKAETKAMTAQDEAVVVSIDRAGKVFVNSTEVASGDLTAKLTAMVANRAKKEVFLK
FT                   ADRDVPYGQVVKTMAEIKGAGIERLGMVTEPAPGK"
     MEVGSRNSGD RGTMSQINVT PLVDVMLVLL IIFMVTAPMM QQGVQVNLPK AETKAMTAQD        60
     EAVVVSIDRA GKVFVNSTEV ASGDLTAKLT AMVANRAKKE VFLKADRDVP YGQVVKTMAE       120
     IKGAGIERLG MVTEPAPGK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page