(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE280

CP002031.PE280       Location/Qualifiers
FT   CDS             311211..312314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0282"
FT                   /product="GspIIEN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83145"
FT                   /protein_id="ADI83145.1"
FT                   /translation="MPIRLGEMLIKAGMITHTQLDEALKGQVIFGGRLGTNLIEMGVIG
FT                   EEELARVLSEKLRVPCVDPDELMAVPDHLLSLVPRDMVERYKIVPLGVDGRRLRLVMAD
FT                   PSDLPAIDEIAFRTGFVIVPMVAPEIRLFMALEKYYGIRREVRALPVSETLGGRRCTYG
FT                   TKRPAEQLMRRDVVDFSTLPDNGKYLPWEGGDIDDNRIEAAERYTIDALSRTLADCRER
FT                   DAVADALVDYAGRLFGCAGLLLVMRDMAAGWEAVAGHERLREFGQLRISLQEASHVRTV
FT                   VEERSVYLGPPGNMPTDRRLAEALGGAGAPGLMLVPMVMGRRVVTILCAAGEMVALGAR
FT                   LSEAQTIARKGVLAFEILILRGKILMT"
     MPIRLGEMLI KAGMITHTQL DEALKGQVIF GGRLGTNLIE MGVIGEEELA RVLSEKLRVP        60
     CVDPDELMAV PDHLLSLVPR DMVERYKIVP LGVDGRRLRL VMADPSDLPA IDEIAFRTGF       120
     VIVPMVAPEI RLFMALEKYY GIRREVRALP VSETLGGRRC TYGTKRPAEQ LMRRDVVDFS       180
     TLPDNGKYLP WEGGDIDDNR IEAAERYTID ALSRTLADCR ERDAVADALV DYAGRLFGCA       240
     GLLLVMRDMA AGWEAVAGHE RLREFGQLRI SLQEASHVRT VVEERSVYLG PPGNMPTDRR       300
     LAEALGGAGA PGLMLVPMVM GRRVVTILCA AGEMVALGAR LSEAQTIARK GVLAFEILIL       360
     RGKILMT                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page