(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE281

CP002031.PE281       Location/Qualifiers
FT   CDS             complement(312283..312711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83146"
FT                   /protein_id="ADI83146.2"
FT                   /translation="MRQALAELSVLPGAIGSLVTDRGGKILERVFPPLFDDTTLSAVSE
FT                   DLAECVITLGISSVSTETLFLRYTEGIVAIKPLDDGLLLLLCTRESSGKSITCAIDAAA
FT                   ARLRRVMSPAPPSVQVGPNGPASDRLAIAMSSESYPAK"
     MRQALAELSV LPGAIGSLVT DRGGKILERV FPPLFDDTTL SAVSEDLAEC VITLGISSVS        60
     TETLFLRYTE GIVAIKPLDD GLLLLLCTRE SSGKSITCAI DAAAARLRRV MSPAPPSVQV       120
     GPNGPASDRL AIAMSSESYP AK                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page