(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE324

CP002031.PE324       Location/Qualifiers
FT   CDS             complement(354733..355236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0326"
FT                   /product="periplasmic nitrate reductase, iron-sulfur
FT                   cluster-binding subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83189"
FT                   /protein_id="ADI83189.2"
FT                   /translation="MAGRWFLFRFLSGYWSAARNIGAATPVCRPPRFKETASGSCGDCT
FT                   ACRDACPSAIIVRDFARKGPHLDFFQGRCTFCYLCAGACPKGILTLPNEGERMVIGRAR
FT                   LIRDRCLVREGCSVCIERCPEGALTLIFGRTIRVSKRKCTGCGGCRHVCPAKPNAMSIE
FT                   PLNG"
     MAGRWFLFRF LSGYWSAARN IGAATPVCRP PRFKETASGS CGDCTACRDA CPSAIIVRDF        60
     ARKGPHLDFF QGRCTFCYLC AGACPKGILT LPNEGERMVI GRARLIRDRC LVREGCSVCI       120
     ERCPEGALTL IFGRTIRVSK RKCTGCGGCR HVCPAKPNAM SIEPLNG                     167
//

If you have problems or comments...

PBIL Back to PBIL home page