(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE352

CP002031.PE352       Location/Qualifiers
FT   CDS             complement(384083..384772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0354"
FT                   /product="protein of unknown function DUF2466"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83217"
FT                   /protein_id="ADI83217.1"
FT                   /translation="MAGGIKAWPEDERPREKLLRRGAPVLSDAELLALIIRTGDSVTGR
FT                   SAIDLGRALLQECGDLRTLAGATVSELCAVKGMGTAKATSIKAALEMASRINSERLMIC
FT                   SERFTSPEQVYNHYHYAFRDRRKEYFMALLLDGKNRIMREIQVSEGSLNQSIVHPREVF
FT                   NPAVRESAAAVILVHNHPTGDPAPSREDLEITRRLREAGDIMGIRVLDHIIIGDGRFTS
FT                   FVSAGLL"
     MAGGIKAWPE DERPREKLLR RGAPVLSDAE LLALIIRTGD SVTGRSAIDL GRALLQECGD        60
     LRTLAGATVS ELCAVKGMGT AKATSIKAAL EMASRINSER LMICSERFTS PEQVYNHYHY       120
     AFRDRRKEYF MALLLDGKNR IMREIQVSEG SLNQSIVHPR EVFNPAVRES AAAVILVHNH       180
     PTGDPAPSRE DLEITRRLRE AGDIMGIRVL DHIIIGDGRF TSFVSAGLL                   229
//

If you have problems or comments...

PBIL Back to PBIL home page