(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE356

CP002031.PE356       Location/Qualifiers
FT   CDS             complement(387536..388018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0358"
FT                   /product="protein of unknown function DUF2062"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83221"
FT                   /protein_id="ADI83221.1"
FT                   /translation="MLNKEKWKKNIKAILSLDSHPGHIAAGFAVGVFISFTPFFAFHTL
FT                   MAIAAAFIFRLNKLTCITGAWVNTPLTVVPVLAISYKLGRVMRGLPPAELSFHGLDWHA
FT                   LKPHATSLLLGTSVIGFVAAVVAYVICYWLVVRFRRKDETLATLAEEMEEVGEELE"
     MLNKEKWKKN IKAILSLDSH PGHIAAGFAV GVFISFTPFF AFHTLMAIAA AFIFRLNKLT        60
     CITGAWVNTP LTVVPVLAIS YKLGRVMRGL PPAELSFHGL DWHALKPHAT SLLLGTSVIG       120
     FVAAVVAYVI CYWLVVRFRR KDETLATLAE EMEEVGEELE                             160
//

If you have problems or comments...

PBIL Back to PBIL home page