(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE360

CP002031.PE360       Location/Qualifiers
FT   CDS             390909..394142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0362"
FT                   /product="efflux pump, RND family, inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83225"
FT                   /protein_id="ADI83225.1"
FT                   /translation="MDTHHLGFAGKIARAFIDSKLTPLIVIASLLLGVYAVLVTPREEE
FT                   PQIVVPMVDIYLPMPGSTPQEVEERVVSPIERKMWELNGVEYVYAMSRPGMGLVTVRFL
FT                   VGENMEDSLVKLYNKLMSNRGLLPPGAGEPLVVPKSIDDVPILSLTLWSERYDGFMLRR
FT                   IAREICDELKKGENVAEAEIKGGLNRTLSVRLDSARLAAYNLSPLQVAAAIHAGNASLQ
FT                   SGAFAADNRETIVETGSFIADADDARRLVVGVFNGRPVYLADVATVTDGAPEPANYVFF
FT                   GLGPAAGTKGISGNQAENYPAVTIAVAKRKGANATWVAEDLLHRVEALKGKVIPSDVKV
FT                   TVTRNYGETAREKNNELLYHMFLAAISVTILIAVFMGWRAGAVAAIAIPVTLALTMLVF
FT                   NQIGYTLNRITLFALIFSIGILVDDAIVVVENIHRYFTTTRFKPLEAAIRAVDEIGNPT
FT                   VLATFAVIASILPMGFVGGLMGPYMRPIPVGASMAMLLSMFIAFIVTPYFAYRLMKGES
FT                   HYGSDAAAEESKLTVFYRKAMGALLHNRPLRAGFMIGVAVLLVASCSLLYFKLVTVKML
FT                   PFDNKNELQVIIDAPEGTPLEETARMTAEMGQALRGIPEVTDFQMYVGTSAPFNFNGLV
FT                   RHYYLRTGSHVADIQVNFVHKSERAAQSHDLAKRIRPLLKAVADRHGARIKVAEVPPGP
FT                   PVLSTLVTEVYGPDHATRLDIARKIKAIYEKVDGVVDTDWYVEDDQPKVSFAVDREKAA
FT                   LSGISVEDVSRTLRMALGGVDAGIMHLPREKEPVAINVRLPAAQRSSVEALSSIYVPGP
FT                   RGNVPLSQLVRVSTGVEDQTLYRKNLKSVVYVTGDVAGAIEAPVYAILQMQKEIDKIPL
FT                   PGGYRIEQRAATQPWSEERPGIKWDGEWHITYEVFRDLGLAFGAVMILIYLLVVAWFKD
FT                   FTTPLVIMGPIPLTLIGILPGHALFGAFFTATSMIGFIALAGIIVRNSIILIDFAEMKR
FT                   REGLPLDEAIIEAGAVRFRPMLLTGAAVVVGSFVIVFDPIFQGLALALMFGEIASTTLS
FT                   RVTIPIVYFLVERWKEKRRNSDVLVEEKG"
     MDTHHLGFAG KIARAFIDSK LTPLIVIASL LLGVYAVLVT PREEEPQIVV PMVDIYLPMP        60
     GSTPQEVEER VVSPIERKMW ELNGVEYVYA MSRPGMGLVT VRFLVGENME DSLVKLYNKL       120
     MSNRGLLPPG AGEPLVVPKS IDDVPILSLT LWSERYDGFM LRRIAREICD ELKKGENVAE       180
     AEIKGGLNRT LSVRLDSARL AAYNLSPLQV AAAIHAGNAS LQSGAFAADN RETIVETGSF       240
     IADADDARRL VVGVFNGRPV YLADVATVTD GAPEPANYVF FGLGPAAGTK GISGNQAENY       300
     PAVTIAVAKR KGANATWVAE DLLHRVEALK GKVIPSDVKV TVTRNYGETA REKNNELLYH       360
     MFLAAISVTI LIAVFMGWRA GAVAAIAIPV TLALTMLVFN QIGYTLNRIT LFALIFSIGI       420
     LVDDAIVVVE NIHRYFTTTR FKPLEAAIRA VDEIGNPTVL ATFAVIASIL PMGFVGGLMG       480
     PYMRPIPVGA SMAMLLSMFI AFIVTPYFAY RLMKGESHYG SDAAAEESKL TVFYRKAMGA       540
     LLHNRPLRAG FMIGVAVLLV ASCSLLYFKL VTVKMLPFDN KNELQVIIDA PEGTPLEETA       600
     RMTAEMGQAL RGIPEVTDFQ MYVGTSAPFN FNGLVRHYYL RTGSHVADIQ VNFVHKSERA       660
     AQSHDLAKRI RPLLKAVADR HGARIKVAEV PPGPPVLSTL VTEVYGPDHA TRLDIARKIK       720
     AIYEKVDGVV DTDWYVEDDQ PKVSFAVDRE KAALSGISVE DVSRTLRMAL GGVDAGIMHL       780
     PREKEPVAIN VRLPAAQRSS VEALSSIYVP GPRGNVPLSQ LVRVSTGVED QTLYRKNLKS       840
     VVYVTGDVAG AIEAPVYAIL QMQKEIDKIP LPGGYRIEQR AATQPWSEER PGIKWDGEWH       900
     ITYEVFRDLG LAFGAVMILI YLLVVAWFKD FTTPLVIMGP IPLTLIGILP GHALFGAFFT       960
     ATSMIGFIAL AGIIVRNSII LIDFAEMKRR EGLPLDEAII EAGAVRFRPM LLTGAAVVVG      1020
     SFVIVFDPIF QGLALALMFG EIASTTLSRV TIPIVYFLVE RWKEKRRNSD VLVEEKG         1077
//

If you have problems or comments...

PBIL Back to PBIL home page