(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE361

CP002031.PE361       Location/Qualifiers
FT   CDS             394117..394545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0363"
FT                   /product="redox-active protein, C_GCAxxG_C_C family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83226"
FT                   /protein_id="ADI83226.1"
FT                   /translation="MFWLKKKDNAPADSLAEQVGLDAEGFYRTGRMHCAEAVLMAMRNA
FT                   YSPEMPQDVVRVAAGFGGGSNAGCLCGAVSGGTMAFGLAVKEDKRRVNRLTRQLHDWFK
FT                   HEYGATCCRIATKNAKGKGGCAVLTGEVAKKAAELLEE"
     MFWLKKKDNA PADSLAEQVG LDAEGFYRTG RMHCAEAVLM AMRNAYSPEM PQDVVRVAAG        60
     FGGGSNAGCL CGAVSGGTMA FGLAVKEDKR RVNRLTRQLH DWFKHEYGAT CCRIATKNAK       120
     GKGGCAVLTG EVAKKAAELL EE                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page