(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE362

CP002031.PE362       Location/Qualifiers
FT   CDS             394559..394771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0364"
FT                   /product="protein of unknown function DUF2892"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83227"
FT                   /protein_id="ADI83227.1"
FT                   /translation="MYIDRMLRIIAGAFIMLSLALAHFHNPNWLWFTAFVGLNLFQSGF
FT                   TNWCPMVYFLEKLGVPKFPKGCCDK"
     MYIDRMLRII AGAFIMLSLA LAHFHNPNWL WFTAFVGLNL FQSGFTNWCP MVYFLEKLGV        60
     PKFPKGCCDK                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page