(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE364

CP002031.PE364       Location/Qualifiers
FT   CDS             395619..395999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0366"
FT                   /product="rhodanese homology domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83229"
FT                   /protein_id="ADI83229.1"
FT                   /translation="MIRKFIIAVFMVTSLAATALAAPYRNIGSAEAKALLDKKRNVFLL
FT                   DVRTPDEYRQARLAGSVLIPINEVERRIAQIPKGRPVLVYCAVGSRSGLVAGYLTQRGY
FT                   GEVYNMHDGIVGWYRNGFPITR"
     MIRKFIIAVF MVTSLAATAL AAPYRNIGSA EAKALLDKKR NVFLLDVRTP DEYRQARLAG        60
     SVLIPINEVE RRIAQIPKGR PVLVYCAVGS RSGLVAGYLT QRGYGEVYNM HDGIVGWYRN       120
     GFPITR                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page