(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE381

CP002031.PE381       Location/Qualifiers
FT   CDS             411832..412341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83246"
FT                   /protein_id="ADI83246.2"
FT                   /translation="MATVMVMSGGPLLAPPVSAPPAGAQPAAGEPQAPAAAAAGKSVVG
FT                   EMALVEAKRQQLAAREAALAVKEQELKNLSAKLEARVKELESAKAALDRSLDARKKVQS
FT                   ANYQKMLKVYKALKPAEAAQLLDKMDEGEVLEILNEMDQKRVAKLLPLMKQERALRWTR
FT                   HSLAAK"
     MATVMVMSGG PLLAPPVSAP PAGAQPAAGE PQAPAAAAAG KSVVGEMALV EAKRQQLAAR        60
     EAALAVKEQE LKNLSAKLEA RVKELESAKA ALDRSLDARK KVQSANYQKM LKVYKALKPA       120
     EAAQLLDKMD EGEVLEILNE MDQKRVAKLL PLMKQERALR WTRHSLAAK                   169
//

If you have problems or comments...

PBIL Back to PBIL home page