(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE394

CP002031.PE394       Location/Qualifiers
FT   CDS             complement(422222..422692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0396"
FT                   /product="bacterial SH3 domain lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83259"
FT                   /protein_id="ADI83259.2"
FT                   /translation="MTLIRLQSRMLIPSLALVVPLLAACTTVTEERGGPQAPGIGFEEA
FT                   PAVVDRTDRQHAPPTPMVQPPPPQAPLPQPPEPPATPAVAVPASLRIGPEHKYVNVRRG
FT                   SSPRTKVVAVLKGGTQLELLGKEGSWLRVRWQHGGKTAEGWVYRKFVEGNGL"
     MTLIRLQSRM LIPSLALVVP LLAACTTVTE ERGGPQAPGI GFEEAPAVVD RTDRQHAPPT        60
     PMVQPPPPQA PLPQPPEPPA TPAVAVPASL RIGPEHKYVN VRRGSSPRTK VVAVLKGGTQ       120
     LELLGKEGSW LRVRWQHGGK TAEGWVYRKF VEGNGL                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page