(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE404

CP002031.PE404       Location/Qualifiers
FT   CDS             complement(434641..435075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83269"
FT                   /protein_id="ADI83269.1"
FT                   /translation="MREQLSRRYLKTFACGTAHKFASSAVHYAWLAHHYGIARVTIDLL
FT                   ALTIEPPEFNIRRNRILAGQCRDSLLCNAKRLKPPGAVTAATLAAEFGVHEHGVDDRFE
FT                   WIGPSTFTVILTDDRGKEWRGKITLDRVLAQGDGVGDPNR"
     MREQLSRRYL KTFACGTAHK FASSAVHYAW LAHHYGIARV TIDLLALTIE PPEFNIRRNR        60
     ILAGQCRDSL LCNAKRLKPP GAVTAATLAA EFGVHEHGVD DRFEWIGPST FTVILTDDRG       120
     KEWRGKITLD RVLAQGDGVG DPNR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page