(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE406

CP002031.PE406       Location/Qualifiers
FT   CDS             complement(435934..436857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0408"
FT                   /product="HNH endonuclease domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83271"
FT                   /protein_id="ADI83271.2"
FT                   /translation="MRRPKENEPELLRRKLVTLLSNFESELKQEDLRRKVLALVPAHHL
FT                   LRDLGSSLIPRDVASAARDRLEQYFLKYPRTVLTGDELMVIAGIGEWARRVRELRVEAG
FT                   YAIVTGIMIKEMKSVDDLPKSEFGKLKPDDYVLLSSEYDRDAAFRWKLANRIRKKNNLS
FT                   MRDKILEFLRANVGKQVTGEELRYVAGNKTEWARRVRELRTEQGWPVVTKTTGMPELPI
FT                   GVYMLVEDKQAEPHDRVIPDNIRRAVLMKSGYKCADCGWHQELWNPSDPRHLELHHMEM
FT                   HMEGGTNTEENLVAVCNVCHDVRHRT"
     MRRPKENEPE LLRRKLVTLL SNFESELKQE DLRRKVLALV PAHHLLRDLG SSLIPRDVAS        60
     AARDRLEQYF LKYPRTVLTG DELMVIAGIG EWARRVRELR VEAGYAIVTG IMIKEMKSVD       120
     DLPKSEFGKL KPDDYVLLSS EYDRDAAFRW KLANRIRKKN NLSMRDKILE FLRANVGKQV       180
     TGEELRYVAG NKTEWARRVR ELRTEQGWPV VTKTTGMPEL PIGVYMLVED KQAEPHDRVI       240
     PDNIRRAVLM KSGYKCADCG WHQELWNPSD PRHLELHHME MHMEGGTNTE ENLVAVCNVC       300
     HDVRHRT                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page