(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE415

CP002031.PE415       Location/Qualifiers
FT   CDS             complement(446433..447158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83282"
FT                   /protein_id="ADI83282.1"
FT                   /translation="MKCPKCGYNSFEFLDNCKKCSHDLSAFKQTHGIRAVVLPLAGLTV
FT                   AAPAVAVAAPSAANAANAEESFTWEVPAAPESFKPGDDIFSDLDLGLSPSPAPAEPASA
FT                   GLDLGDFSFDDTPAAPAVPAPSTTDADAGTDDFATLLETGDNSEITAAAPGAAQVPEME
FT                   SPWEVPTDSFGGFGDTPAPAAEPAASGDFDLESFSWDDKETKTETPPAAPKGPEAGVES
FT                   FPGTDFDSLFGDAGEDEKK"
     MKCPKCGYNS FEFLDNCKKC SHDLSAFKQT HGIRAVVLPL AGLTVAAPAV AVAAPSAANA        60
     ANAEESFTWE VPAAPESFKP GDDIFSDLDL GLSPSPAPAE PASAGLDLGD FSFDDTPAAP       120
     AVPAPSTTDA DAGTDDFATL LETGDNSEIT AAAPGAAQVP EMESPWEVPT DSFGGFGDTP       180
     APAAEPAASG DFDLESFSWD DKETKTETPP AAPKGPEAGV ESFPGTDFDS LFGDAGEDEK       240
     K                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page