(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE421

CP002031.PE421       Location/Qualifiers
FT   CDS             451862..453271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0425"
FT                   /product="sensor histidine kinase, HAMP domain-containing"
FT                   /note="domains: HAMP, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83288"
FT                   /protein_id="ADI83288.1"
FT                   /translation="MFFRSIRFSLTLWYAVTLAVILVLFSSFIYLVLSNQLNKGIDREL
FT                   LTVAEAVASPTLEPFRHAAPSVFDQVLEDFIGTRLTGKHVQVLDGSGAVAASSKSMEEL
FT                   RIPLGKTALRRVQAGKVSYETRVNLDVYPVRTIVYPIMTDGRLDQIVLVGTSMRGPAET
FT                   LEKVQLVFAVSIPLALILWSLGGWFLAGRALKPVDLITRSARKITAENLGLRLEVINPQ
FT                   DEIGRLATTFNDTLERLENAFNRIRQFTGDVSHELRTPLTILRGEAEVGLKWAKEPEEF
FT                   RELLRSNLEEINRMSKIIETLLELSRVEGGVKLELADLDLSDLLAELVQQSRLIAPDKN
FT                   LRIAFVGQEPVTILGDWLRLRQVFMNLLDNAVKYTPADGEISVVVDTTGDSARVAIIDS
FT                   GPGIPPEDLPHIFERFYRVDKARNRADGGCGLGLSLVKTFVEAHGGRIEVVSEAGKGSI
FT                   FTVLLPRVVAG"
     MFFRSIRFSL TLWYAVTLAV ILVLFSSFIY LVLSNQLNKG IDRELLTVAE AVASPTLEPF        60
     RHAAPSVFDQ VLEDFIGTRL TGKHVQVLDG SGAVAASSKS MEELRIPLGK TALRRVQAGK       120
     VSYETRVNLD VYPVRTIVYP IMTDGRLDQI VLVGTSMRGP AETLEKVQLV FAVSIPLALI       180
     LWSLGGWFLA GRALKPVDLI TRSARKITAE NLGLRLEVIN PQDEIGRLAT TFNDTLERLE       240
     NAFNRIRQFT GDVSHELRTP LTILRGEAEV GLKWAKEPEE FRELLRSNLE EINRMSKIIE       300
     TLLELSRVEG GVKLELADLD LSDLLAELVQ QSRLIAPDKN LRIAFVGQEP VTILGDWLRL       360
     RQVFMNLLDN AVKYTPADGE ISVVVDTTGD SARVAIIDSG PGIPPEDLPH IFERFYRVDK       420
     ARNRADGGCG LGLSLVKTFV EAHGGRIEVV SEAGKGSIFT VLLPRVVAG                   469
//

If you have problems or comments...

PBIL Back to PBIL home page