(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE429

CP002031.PE429       Location/Qualifiers
FT   CDS             complement(459709..460734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0433"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83296"
FT                   /protein_id="ADI83296.1"
FT                   /translation="MDIAVTGLAAISAAGVGIEPLRETVAQRQCRLTPVPVEVLGEDGY
FT                   LWGKADGFRAADFMPPLKARKFDRCSLLATVAAGMALADAGIDPKGGDPTRIGIALGCG
FT                   FGGIANSVEFLGGYFSRGVEGLVPMLFPNTVANAAASNASIEHGLKGPNVTQVQRFCSA
FT                   EAAIQMACRFLEEGRADVMLAGGVDELTPLMMAGFQAVGQLRTYARSFSEGCGILVLER
FT                   RDHAERRAARLRGRITGLRTVGMLPAGREQETVDRLMPPAAPALVSLSGIAADITALIA
FT                   PLPAVPTLESGNLIGRSLAMGGLALASLLLVLPEGARGLHLAASPEGPYHAIDVTGGMR
FT                   A"
     MDIAVTGLAA ISAAGVGIEP LRETVAQRQC RLTPVPVEVL GEDGYLWGKA DGFRAADFMP        60
     PLKARKFDRC SLLATVAAGM ALADAGIDPK GGDPTRIGIA LGCGFGGIAN SVEFLGGYFS       120
     RGVEGLVPML FPNTVANAAA SNASIEHGLK GPNVTQVQRF CSAEAAIQMA CRFLEEGRAD       180
     VMLAGGVDEL TPLMMAGFQA VGQLRTYARS FSEGCGILVL ERRDHAERRA ARLRGRITGL       240
     RTVGMLPAGR EQETVDRLMP PAAPALVSLS GIAADITALI APLPAVPTLE SGNLIGRSLA       300
     MGGLALASLL LVLPEGARGL HLAASPEGPY HAIDVTGGMR A                           341
//

If you have problems or comments...

PBIL Back to PBIL home page