(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE441

CP002031.PE441       Location/Qualifiers
FT   CDS             join(470662..471144,471146..471559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83308"
FT                   /protein_id="ADI83308.2"
FT                   /translation="MPSFRSAKTQAEHAVSRKIALGQGRHDHRDDGKIHSVGTARGYEQ
FT                   ALKGATEYVQEHRLGDLRSLTVEIAQQYLADRAAIVSQKTLDIDRQAMQMHLGVRLEVV
FT                   KSELETHLTTRSYTATQVERIASAQSERNSLATQIAHNAGLRAHELLTIRLANERPPPP
FT                   PTHREWSAERFAGREGERYTVEGKGGLVREVLLSRELAAQLEATRLGEPRQVTDRGVNY
FT                   TQHYNIGGGRAWSQSFSAASQRELGFSNGAHGLRHSYAQERMEEMQRGGMNYDDAKGTV
FT                   AQEVGHFDKETTEAYLR"
FT                   /artificial_location="low-quality sequence region"
     MPSFRSAKTQ AEHAVSRKIA LGQGRHDHRD DGKIHSVGTA RGYEQALKGA TEYVQEHRLG        60
     DLRSLTVEIA QQYLADRAAI VSQKTLDIDR QAMQMHLGVR LEVVKSELET HLTTRSYTAT       120
     QVERIASAQS ERNSLATQIA HNAGLRAHEL LTIRLANERP PPPPTHREWS AERFAGREGE       180
     RYTVEGKGGL VREVLLSREL AAQLEATRLG EPRQVTDRGV NYTQHYNIGG GRAWSQSFSA       240
     ASQRELGFSN GAHGLRHSYA QERMEEMQRG GMNYDDAKGT VAQEVGHFDK ETTEAYLR         298
//

If you have problems or comments...

PBIL Back to PBIL home page