(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE442

CP002031.PE442       Location/Qualifiers
FT   CDS             471766..472263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83310"
FT                   /protein_id="ADI83310.1"
FT                   /translation="MKATWPLSLTLLIVSLAAGIAGGYALRDDDNSDRHRRELSDLENR
FT                   YRQRIDAADRKYDQAGIWETNSRRRFKEADQKEAAAKRREKAVEEKEQNIDKIVEEKVQ
FT                   AIRKQFQGLQEDHRNRCHKMEGLEKEKIELKRKNISLEKEVIKLQEENLALTKENLALK
FT                   RK"
     MKATWPLSLT LLIVSLAAGI AGGYALRDDD NSDRHRRELS DLENRYRQRI DAADRKYDQA        60
     GIWETNSRRR FKEADQKEAA AKRREKAVEE KEQNIDKIVE EKVQAIRKQF QGLQEDHRNR       120
     CHKMEGLEKE KIELKRKNIS LEKEVIKLQE ENLALTKENL ALKRK                       165
//

If you have problems or comments...

PBIL Back to PBIL home page