(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE456

CP002031.PE456       Location/Qualifiers
FT   CDS             complement(493564..495432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0461"
FT                   /product="sensor histidine kinase, PAS domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83324"
FT                   /protein_id="ADI83324.1"
FT                   /translation="MTSSDLVSRSARFALVMLFLAALVLTSRVNYLLFHTLTEIVTVVA
FT                   GCGIFMVAWHARRQIDNHCILLIGISHLFVAIITLFHALSYRGMGVFPGAGTNLSTQLW
FT                   IGSRLLQGASLALAPLFVRKRLNPSVTVTAYMAATSLFLLSILCGDIFPLCFSDEVGLT
FT                   PFKKGAEFLAGIFILAALTGLLTKRRHFDARVFRMLSLSLVFLATSGFVFALNTGISSL
FT                   TGMTGHLLTLGGFILIYRAMVETGLERPYDLLFRDLKESEERYRSLYNRTPVMLHSIDR
FT                   EGKIVNVSDFWLETLGYRRDEVLGRLSADFMTDESRSYVIGTVVPEFLRTGRTRDIPLH
FT                   LLTSSGKVIDVLLSSEAERDEEGEIVRSLSVMTDVTEQRRAARQIERLNESLASRAMDL
FT                   EVANGDLEAFNYSVSHDLRSHLTVIRGFSDVLLEICTDKLDDECRSYVRHIGEETGRMN
FT                   GLIGTLLDFSRVARVELERVPVNLSTLAEEIALELRMKDQERMAEFIIIDDADVTADPG
FT                   LMRVVMENLLGNAWKYTGRREQAVIEFGKEEMEGQTVFFVRDNGAGFSSQQADKLFLPF
FT                   QRLHGRSEFPGHGIGLATVHRIISRHGGTIWAQGEEGAGAVFYFTL"
     MTSSDLVSRS ARFALVMLFL AALVLTSRVN YLLFHTLTEI VTVVAGCGIF MVAWHARRQI        60
     DNHCILLIGI SHLFVAIITL FHALSYRGMG VFPGAGTNLS TQLWIGSRLL QGASLALAPL       120
     FVRKRLNPSV TVTAYMAATS LFLLSILCGD IFPLCFSDEV GLTPFKKGAE FLAGIFILAA       180
     LTGLLTKRRH FDARVFRMLS LSLVFLATSG FVFALNTGIS SLTGMTGHLL TLGGFILIYR       240
     AMVETGLERP YDLLFRDLKE SEERYRSLYN RTPVMLHSID REGKIVNVSD FWLETLGYRR       300
     DEVLGRLSAD FMTDESRSYV IGTVVPEFLR TGRTRDIPLH LLTSSGKVID VLLSSEAERD       360
     EEGEIVRSLS VMTDVTEQRR AARQIERLNE SLASRAMDLE VANGDLEAFN YSVSHDLRSH       420
     LTVIRGFSDV LLEICTDKLD DECRSYVRHI GEETGRMNGL IGTLLDFSRV ARVELERVPV       480
     NLSTLAEEIA LELRMKDQER MAEFIIIDDA DVTADPGLMR VVMENLLGNA WKYTGRREQA       540
     VIEFGKEEME GQTVFFVRDN GAGFSSQQAD KLFLPFQRLH GRSEFPGHGI GLATVHRIIS       600
     RHGGTIWAQG EEGAGAVFYF TL                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page