(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE457

CP002031.PE457       Location/Qualifiers
FT   CDS             495764..496924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0463"
FT                   /product="protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83326"
FT                   /protein_id="ADI83326.1"
FT                   /translation="MEQIDDSRLRGIIHDRIKERGGRIPFADFMAACLYEPGLGYYTSP
FT                   GRKVGAEGDFYTSINVHRVFGRLIGREICRMWEVMGCPAPFTLVEAGAGHGRLAADVLD
FT                   AVRELNPELYASLTLRLVEAEPSLAEAQRQVLAEHLDRVAWNDPAELMGGTLTFTGCLY
FT                   SNELIDSFPTHVVEMTPAGLREVFVTADGDGFAEQLDLPSTPDLADYFRRIDVNLQPGQ
FT                   RTEINLNACRWLEGVARCLERGFVLTVDYGFLSPELYGPMRQNGTLLCYFRHTIQEDPY
FT                   QRVGHQDITSHVDFTTLILRGEELGLHKAWFGEQYRFLMAAGLMEELMALEAAAATEEE
FT                   RIKIRLVLKKLVLPEGGMGDTFKILVQAKGVENPRLLCMRDWSKLF"
     MEQIDDSRLR GIIHDRIKER GGRIPFADFM AACLYEPGLG YYTSPGRKVG AEGDFYTSIN        60
     VHRVFGRLIG REICRMWEVM GCPAPFTLVE AGAGHGRLAA DVLDAVRELN PELYASLTLR       120
     LVEAEPSLAE AQRQVLAEHL DRVAWNDPAE LMGGTLTFTG CLYSNELIDS FPTHVVEMTP       180
     AGLREVFVTA DGDGFAEQLD LPSTPDLADY FRRIDVNLQP GQRTEINLNA CRWLEGVARC       240
     LERGFVLTVD YGFLSPELYG PMRQNGTLLC YFRHTIQEDP YQRVGHQDIT SHVDFTTLIL       300
     RGEELGLHKA WFGEQYRFLM AAGLMEELMA LEAAAATEEE RIKIRLVLKK LVLPEGGMGD       360
     TFKILVQAKG VENPRLLCMR DWSKLF                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page