(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE462

CP002031.PE462       Location/Qualifiers
FT   CDS             499816..500016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83331"
FT                   /protein_id="ADI83331.1"
FT                   /translation="MGYKVKTFGMELRPLKAMQELFALDAMVNAFVAENGVKRIVSVSD
FT                   SPTTDDKGETIGLVRVVAYED"
     MGYKVKTFGM ELRPLKAMQE LFALDAMVNA FVAENGVKRI VSVSDSPTTD DKGETIGLVR        60
     VVAYED                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page