(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE474

CP002031.PE474       Location/Qualifiers
FT   CDS             513463..514722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0481"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83344"
FT                   /protein_id="ADI83344.1"
FT                   /translation="MKRVVIIGMGFGGIRAARTLAQKGLDVVLVDRNNYHLFQPLLYQV
FT                   ATAGLEQESIAYPVRAMARGWTGTRFQLAEVTGVDFEARQVVTDNGTIPYDYLVIGAGS
FT                   VTNYFGLKSVEQHAFDLKELVDAERLRNHILTAFERAVVEPDPAKRRALMTFVIVGGGP
FT                   TGVEFAGALIELVRYVLTKDYPELSVQAARVVLVEAFDRLLAAMPAELQGYTLEKLRGM
FT                   GVEVLLNARVVDAGPERVTLHDGAVIPAHTLFWSAGVKAAPLAATLGVEQNPGGRIAVE
FT                   PDLTLPGHPDVYVVGDMAWLEQDGAPLPMVAPVAMQMGIHAGKSILAREQGAPAPPFRY
FT                   HDKGSMATIGRSAAVASAFGMNLRGYAAWIAWLLLHLYYLIGFRNRIVVMLNWIWYYWF
FT                   HERQVRLITERETPGNGCTR"
     MKRVVIIGMG FGGIRAARTL AQKGLDVVLV DRNNYHLFQP LLYQVATAGL EQESIAYPVR        60
     AMARGWTGTR FQLAEVTGVD FEARQVVTDN GTIPYDYLVI GAGSVTNYFG LKSVEQHAFD       120
     LKELVDAERL RNHILTAFER AVVEPDPAKR RALMTFVIVG GGPTGVEFAG ALIELVRYVL       180
     TKDYPELSVQ AARVVLVEAF DRLLAAMPAE LQGYTLEKLR GMGVEVLLNA RVVDAGPERV       240
     TLHDGAVIPA HTLFWSAGVK AAPLAATLGV EQNPGGRIAV EPDLTLPGHP DVYVVGDMAW       300
     LEQDGAPLPM VAPVAMQMGI HAGKSILARE QGAPAPPFRY HDKGSMATIG RSAAVASAFG       360
     MNLRGYAAWI AWLLLHLYYL IGFRNRIVVM LNWIWYYWFH ERQVRLITER ETPGNGCTR        419
//

If you have problems or comments...

PBIL Back to PBIL home page