(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE477

CP002031.PE477       Location/Qualifiers
FT   CDS             517349..518056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0484"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83347"
FT                   /protein_id="ADI83347.1"
FT                   /translation="MGAVVRLDNVAKVYTMGDQRVEALRGISFSVEQGEFIAIMGSSGS
FT                   GKSTCMNMLGCLDVPTSGTYLLEGVNVGDLSQNELAAIRNRKLGFVFQGFNLLPRTTAR
FT                   ENVELPLVYAGVNAAQRRERALAALAMVGLAERAGHYSNQLSGGQQQRVAIARALVNAP
FT                   ALLLADEPTGNLDSTTSEEIMRIFAELHGKGITILMVTHEPDIAAWASRSITFRDGRII
FT                   ADTTVPAPGEGQA"
     MGAVVRLDNV AKVYTMGDQR VEALRGISFS VEQGEFIAIM GSSGSGKSTC MNMLGCLDVP        60
     TSGTYLLEGV NVGDLSQNEL AAIRNRKLGF VFQGFNLLPR TTARENVELP LVYAGVNAAQ       120
     RRERALAALA MVGLAERAGH YSNQLSGGQQ QRVAIARALV NAPALLLADE PTGNLDSTTS       180
     EEIMRIFAEL HGKGITILMV THEPDIAAWA SRSITFRDGR IIADTTVPAP GEGQA            235
//

If you have problems or comments...

PBIL Back to PBIL home page