(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE48

CP002031.PE48        Location/Qualifiers
FT   CDS             complement(55665..56267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0048"
FT                   /product="outer membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82911"
FT                   /protein_id="ADI82911.1"
FT                   /translation="MKRLIALLCLTLTVAAGSGTALAENIKGRLGITGKIGFYLPGDSD
FT                   FDNYKLETDAGFLGGGGLIYGVTDNLAAEVDVTYTKFGAELVSGLDQGDFSVTNIAMGV
FT                   QYRFDTPQPKLSPYAGGGIDILISDYDRPGGADVDPTVGVHLCGGLDYFLTKHLVLNAE
FT                   VRGVVAPEVDIDAPGGKSGNFDPSGVAATFGVRLFFN"
     MKRLIALLCL TLTVAAGSGT ALAENIKGRL GITGKIGFYL PGDSDFDNYK LETDAGFLGG        60
     GGLIYGVTDN LAAEVDVTYT KFGAELVSGL DQGDFSVTNI AMGVQYRFDT PQPKLSPYAG       120
     GGIDILISDY DRPGGADVDP TVGVHLCGGL DYFLTKHLVL NAEVRGVVAP EVDIDAPGGK       180
     SGNFDPSGVA ATFGVRLFFN                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page