(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE492

CP002031.PE492       Location/Qualifiers
FT   CDS             531876..533000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0500"
FT                   /product="leucyl aminopeptidase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83363"
FT                   /protein_id="ADI83363.1"
FT                   /translation="MYREAFASLFGINMGVTAGERILVFGDRARSDEVLSAEDAVRRQR
FT                   LLAVAEEAGRYADTSYGNASFVSFPATAASGAEPPEVLWRAAFGDAAVNALAAEGVLTR
FT                   LLAKEATPEDLERARRVVLSNRHAAAQVVVALSNNSTSHTRFRHLVNAVGGRFASLPHF
FT                   DPDMFFSSMRVDWHQLAERTRRVADAVNGATALRVETPNGTRMSFSKEGRVAKGDDGLL
FT                   SAAGSFGNLPAGEVYLAPLEGTSEGVMVLEWGPTRRLDTPVELVVRAGAVVEVRGDDLL
FT                   RAALERKFAESDLNRNIAELGIGTNDRATRPDNVLEAEKILGTIHIALGDNSGFGGTVQ
FT                   TPFHEDYVFYRPTLILVSEAGTETVLLRNGSLLL"
     MYREAFASLF GINMGVTAGE RILVFGDRAR SDEVLSAEDA VRRQRLLAVA EEAGRYADTS        60
     YGNASFVSFP ATAASGAEPP EVLWRAAFGD AAVNALAAEG VLTRLLAKEA TPEDLERARR       120
     VVLSNRHAAA QVVVALSNNS TSHTRFRHLV NAVGGRFASL PHFDPDMFFS SMRVDWHQLA       180
     ERTRRVADAV NGATALRVET PNGTRMSFSK EGRVAKGDDG LLSAAGSFGN LPAGEVYLAP       240
     LEGTSEGVMV LEWGPTRRLD TPVELVVRAG AVVEVRGDDL LRAALERKFA ESDLNRNIAE       300
     LGIGTNDRAT RPDNVLEAEK ILGTIHIALG DNSGFGGTVQ TPFHEDYVFY RPTLILVSEA       360
     GTETVLLRNG SLLL                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page